PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C024115P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family NAC
Protein Properties Length: 152aa    MW: 17840.5 Da    PI: 9.6373
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C024115P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1782.5e-5581361128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                     +ppGfrFhPt+eelv +yLk+k++++k++l +vi ++d+yk+ePwd+++  k+   e+kewyfFs++d+ky+tg+r+nrat++g+Wkatg+dk+v
  MELO3C024115P1   8 VPPGFRFHPTEEELVGYYLKRKINSQKIDL-DVIIDIDLYKMEPWDIQAncKFGYdEQKEWYFFSHKDRKYPTGSRTNRATSAGFWKATGRDKAV 101
                     69****************************.99**************953433223677************************************ PP

             NAM  93 lskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                     ls k++++g++ktLvfykgrap+g+ktdW+mheyrl
  MELO3C024115P1 102 LS-KNRVIGMRKTLVFYKGRAPNGRKTDWIMHEYRL 136
                     **.8999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.44E-576141IPR003441NAC domain
PROSITE profilePS5100554.3098151IPR003441NAC domain
PfamPF023656.8E-309136IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 152 aa     Download sequence    Send to blast
MEILESCVPP GFRFHPTEEE LVGYYLKRKI NSQKIDLDVI IDIDLYKMEP WDIQANCKFG  60
YDEQKEWYFF SHKDRKYPTG SRTNRATSAG FWKATGRDKA VLSKNRVIGM RKTLVFYKGR  120
APNGRKTDWI MHEYRLQTSE LAPIQASFLI Y*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-52513612140Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6817961e-163LN681796.1 Cucumis melo genomic scaffold, anchoredscaffold00065.
GenBankLN7132551e-163LN713255.1 Cucumis melo genomic chromosome, chr_1.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004149423.11e-106PREDICTED: NAC domain-containing protein 7
RefseqXP_008461973.11e-107PREDICTED: NAC domain-containing protein 7-like
SwissprotQ9C8W95e-93NAC30_ARATH; NAC domain-containing protein 30
TrEMBLA0A0A0K4F01e-106A0A0A0K4F0_CUCSA; Uncharacterized protein
STRINGPOPTR_0013s11740.15e-94(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF71383247
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71930.18e-87vascular related NAC-domain protein 7